| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
| Family c.31.1.0: automated matches [191352] (1 protein) not a true family |
| Protein automated matches [190312] (14 species) not a true protein |
| Species Zymomonas mobilis [TaxId:542] [255669] (6 PDB entries) |
| Domain d2wvaf2: 2wva F:188-362 [244295] Other proteins in same PDB: d2wvaa1, d2wvaa3, d2wvab1, d2wvab3, d2wvae1, d2wvae3, d2wvaf1, d2wvaf3, d2wvav1, d2wvav3, d2wvax1, d2wvax3, d2wvay1, d2wvay3, d2wvaz1, d2wvaz3 automated match to d1zpda1 complexed with mg, pyr, tpu |
PDB Entry: 2wva (more details), 2.2 Å
SCOPe Domain Sequences for d2wvaf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wvaf2 c.31.1.0 (F:188-362) automated matches {Zymomonas mobilis [TaxId: 542]}
easdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggavatmaaak
sffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipdpkklvla
eprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapadps
Timeline for d2wvaf2: