Lineage for d1qcre1 (1qcr E:70-196)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 372359Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 372360Superfamily b.33.1: ISP domain [50022] (2 families) (S)
  5. 372361Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (7 proteins)
  6. 372379Protein ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain [50024] (3 species)
  7. 372390Species Cow (Bos taurus) [TaxId:9913] [50025] (10 PDB entries)
  8. 372400Domain d1qcre1: 1qcr E:70-196 [24429]
    Other proteins in same PDB: d1qcra1, d1qcra2, d1qcrb1, d1qcrb2, d1qcrc2, d1qcrc3, d1qcrd2, d1qcrd3, d1qcre2, d1qcrf_, d1qcrg_, d1qcrh_, d1qcrj_, d1qcrk_
    complexed with hem

Details for d1qcre1

PDB Entry: 1qcr (more details), 2.7 Å

PDB Description: crystal structure of bovine mitochondrial cytochrome bc1 complex, alpha carbon atoms only

SCOP Domain Sequences for d1qcre1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qcre1 b.33.1.1 (E:70-196) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Cow (Bos taurus)}
amskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdpqhdlervkk
pewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnlevpsyefts
ddmvivg

SCOP Domain Coordinates for d1qcre1:

Click to download the PDB-style file with coordinates for d1qcre1.
(The format of our PDB-style files is described here.)

Timeline for d1qcre1: