Lineage for d1qcre1 (1qcr E:70-196)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.33: ISP domain [50021] (1 superfamily) Superfamily b.33.1: ISP domain [50022] (2 families) 
Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (4 proteins) Protein ISP subunit of the mitochondrial cytochrome bc1-complex, watersoluble domain [50024] (3 species) Species Cow (Bos taurus) [TaxId:9913] [50025] (4 PDB entries) 
Domain d1qcre1: 1qcr E:70-196 [24429]
Other proteins in same PDB: d1qcra1, d1qcra2, d1qcrb1, d1qcrb2, d1qcrc1, d1qcrd2, d1qcrd3, d1qcre2, d1qcrf1, d1qcrg1, d1qcrh1, d1qcrj1, d1qcrk1
Details for d1qcre1
PDB Entry: 1qcr (more details), 2.7 Å
PDB Description: crystal structure of bovine mitochondrial cytochrome bc1 complex, alpha carbon atoms only
SCOP Domain Sequences for d1qcre1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qcre1 b.33.1.1 (E:70-196) ISP subunit of the mitochondrial cytochrome bc1-complex, watersoluble domain {Cow (Bos taurus)}
amskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdpqhdlervkk
pewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnlevpsyefts
ddmvivg
SCOP Domain Coordinates for d1qcre1:
Click to download the PDB-style file with coordinates for d1qcre1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qcre1:
View in 3D
