Lineage for d2wvaa3 (2wva A:363-566)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1844143Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1844144Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 1844736Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. 1844737Protein automated matches [227126] (15 species)
    not a true protein
  7. 1845015Species Zymomonas mobilis [TaxId:542] [255668] (5 PDB entries)
  8. 1845049Domain d2wvaa3: 2wva A:363-566 [244287]
    Other proteins in same PDB: d2wvaa2, d2wvab2, d2wvae2, d2wvaf2, d2wvav2, d2wvax2, d2wvay2, d2wvaz2
    automated match to d1zpda3
    complexed with mg, pyr, tpu

Details for d2wvaa3

PDB Entry: 2wva (more details), 2.2 Å

PDB Description: structural insights into the pre-reaction state of pyruvate decarboxylase from zymomonas mobilis
PDB Compounds: (A:) pyruvate decarboxylase

SCOPe Domain Sequences for d2wvaa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wvaa3 c.36.1.0 (A:363-566) automated matches {Zymomonas mobilis [TaxId: 542]}
aplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvpaa
fgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytievmihdgpyn
niknwdyaglmevfngnggydsgagkglkaktggelaeaikvalantdgptliecfigre
dcteelvkwgkrvaaansrkpvnk

SCOPe Domain Coordinates for d2wvaa3:

Click to download the PDB-style file with coordinates for d2wvaa3.
(The format of our PDB-style files is described here.)

Timeline for d2wvaa3: