| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) ![]() |
| Family c.33.1.0: automated matches [191389] (1 protein) not a true family |
| Protein automated matches [190499] (25 species) not a true protein |
| Species Acinetobacter baumannii [TaxId:509173] [255667] (2 PDB entries) |
| Domain d2wtaa_: 2wta A: [244280] automated match to d3hu5a_ complexed with cl, gol, vgl, zn |
PDB Entry: 2wta (more details), 1.7 Å
SCOPe Domain Sequences for d2wtaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wtaa_ c.33.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 509173]}
mnkqpqnsalvvvdvqngftpggnlavadadtiiptinqlagcfenvvltqdwhpdnhis
faanhpgkqpfetieldygsqvlwpkhciqgthdaefhpdlniptaqliirkgfhahids
ysafmeadhttmtgltgylkergidtvyvvgiatdfcvawtaldavkqgfktlviedack
gidlngsleqawqtmqqqgvvriqstdllnec
Timeline for d2wtaa_: