Lineage for d2wtaa_ (2wta A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1592439Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1592440Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 1592474Family c.33.1.0: automated matches [191389] (1 protein)
    not a true family
  6. 1592475Protein automated matches [190499] (20 species)
    not a true protein
  7. 1592476Species Acinetobacter baumannii [TaxId:509173] [255667] (2 PDB entries)
  8. 1592477Domain d2wtaa_: 2wta A: [244280]
    automated match to d3hu5a_
    complexed with cl, gol, vgl, zn

Details for d2wtaa_

PDB Entry: 2wta (more details), 1.7 Å

PDB Description: acinetobacter baumanii nicotinamidase pyrazinamidease
PDB Compounds: (A:) Nicotinamidase

SCOPe Domain Sequences for d2wtaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wtaa_ c.33.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 509173]}
mnkqpqnsalvvvdvqngftpggnlavadadtiiptinqlagcfenvvltqdwhpdnhis
faanhpgkqpfetieldygsqvlwpkhciqgthdaefhpdlniptaqliirkgfhahids
ysafmeadhttmtgltgylkergidtvyvvgiatdfcvawtaldavkqgfktlviedack
gidlngsleqawqtmqqqgvvriqstdllnec

SCOPe Domain Coordinates for d2wtaa_:

Click to download the PDB-style file with coordinates for d2wtaa_.
(The format of our PDB-style files is described here.)

Timeline for d2wtaa_: