![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
![]() | Superfamily b.33.1: ISP domain [50022] (4 families) ![]() |
![]() | Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins) |
![]() | Protein ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain [50024] (3 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [50025] (19 PDB entries) |
![]() | Domain d1be3e1: 1be3 E:70-196 [24428] Other proteins in same PDB: d1be3a1, d1be3a2, d1be3b1, d1be3b2, d1be3c2, d1be3c3, d1be3d2, d1be3d3, d1be3e2, d1be3f_, d1be3g_, d1be3h_, d1be3i_, d1be3j_, d1be3k_ complexed with fes, hec, hem |
PDB Entry: 1be3 (more details), 3 Å
SCOPe Domain Sequences for d1be3e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1be3e1 b.33.1.1 (E:70-196) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Cow (Bos taurus) [TaxId: 9913]} amskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdpqhdlervkk pewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnlevpsyefts ddmvivg
Timeline for d1be3e1: