Lineage for d2wsda1 (2wsd A:2-182)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2366402Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2366403Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2367979Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2367980Protein automated matches [190824] (23 species)
    not a true protein
  7. 2368096Species Bacillus subtilis [TaxId:1423] [255666] (7 PDB entries)
  8. 2368097Domain d2wsda1: 2wsd A:2-182 [244275]
    automated match to d1gska1
    complexed with cu, edo, oxy; mutant

Details for d2wsda1

PDB Entry: 2wsd (more details), 1.6 Å

PDB Description: proximal mutations at the type 1 cu site of cota-laccase: i494a mutant
PDB Compounds: (A:) spore coat protein a

SCOPe Domain Sequences for d2wsda1:

Sequence, based on SEQRES records: (download)

>d2wsda1 b.6.1.0 (A:2-182) automated matches {Bacillus subtilis [TaxId: 1423]}
tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie
vkrnenvyvkwmnnlpsthflpidhtihhsdsqheepevktvvhlhggvtpddsdgypea
wfskdfeqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekr
l

Sequence, based on observed residues (ATOM records): (download)

>d2wsda1 b.6.1.0 (A:2-182) automated matches {Bacillus subtilis [TaxId: 1423]}
tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie
vkrnenvyvkwmnnlpsthflpidhtihheepevktvvhlhggvtpddsdgypeawfskd
feqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekrl

SCOPe Domain Coordinates for d2wsda1:

Click to download the PDB-style file with coordinates for d2wsda1.
(The format of our PDB-style files is described here.)

Timeline for d2wsda1: