Lineage for d2wrhk_ (2wrh K:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645931Protein automated matches [254646] (36 species)
    not a true protein
  7. 2646000Species Influenza A virus (a/mallard/alberta/35/1976(h1n1)) [TaxId:352520] [255663] (1 PDB entry)
  8. 2646002Domain d2wrhk_: 2wrh K: [244271]
    Other proteins in same PDB: d2wrhh_, d2wrhj_, d2wrhl_
    automated match to d1rd8b_
    complexed with sia

Details for d2wrhk_

PDB Entry: 2wrh (more details), 3 Å

PDB Description: structure of h1 duck albert hemagglutinin with human receptor
PDB Compounds: (K:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d2wrhk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wrhk_ h.3.1.1 (K:) automated matches {Influenza A virus (a/mallard/alberta/35/1976(h1n1)) [TaxId: 352520]}
glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitskvnsviekmn
tqftavgkefnnlerrienlnkkvddgfldvwtynaellvllenertldfhdsnvrnlye
kvksqlrnnakeigngcfefyhkcddecmesvkngtydyp

SCOPe Domain Coordinates for d2wrhk_:

Click to download the PDB-style file with coordinates for d2wrhk_.
(The format of our PDB-style files is described here.)

Timeline for d2wrhk_: