![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
![]() | Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
![]() | Protein automated matches [254646] (36 species) not a true protein |
![]() | Species Influenza A virus (a/mallard/alberta/35/1976(h1n1)) [TaxId:352520] [255663] (1 PDB entry) |
![]() | Domain d2wrhk_: 2wrh K: [244271] Other proteins in same PDB: d2wrhh_, d2wrhj_, d2wrhl_ automated match to d1rd8b_ complexed with sia |
PDB Entry: 2wrh (more details), 3 Å
SCOPe Domain Sequences for d2wrhk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wrhk_ h.3.1.1 (K:) automated matches {Influenza A virus (a/mallard/alberta/35/1976(h1n1)) [TaxId: 352520]} glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitskvnsviekmn tqftavgkefnnlerrienlnkkvddgfldvwtynaellvllenertldfhdsnvrnlye kvksqlrnnakeigngcfefyhkcddecmesvkngtydyp
Timeline for d2wrhk_: