Class b: All beta proteins [48724] (180 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein automated matches [190291] (19 species) not a true protein |
Species Influenza A virus (a/mallard/alberta/35/1976(h1n1)) [TaxId:352520] [255664] (1 PDB entry) |
Domain d2wrhj_: 2wrh J: [244270] Other proteins in same PDB: d2wrhi_, d2wrhk_, d2wrhm_ automated match to d1rd8a_ complexed with sia |
PDB Entry: 2wrh (more details), 3 Å
SCOPe Domain Sequences for d2wrhj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wrhj_ b.19.1.2 (J:) automated matches {Influenza A virus (a/mallard/alberta/35/1976(h1n1)) [TaxId: 352520]} dticvgyhannstdtvdtvleknvtvthsvnlledshngklcslgiaplqlgkcnvagwl lgnpecdllltanswsyiietsnsengtcypgefidyeelreqlssvssfekfeifpkas swpnhetkgvtaacsysgassfyrnllwitkkgtsypklsksytnnkgkevlvlwgvhhp psvseqqslyqnadayvsvgsskynrrfapeiaarpkvrgqagrmnyywtlldqgdtitf eatgnliapwyafalnkgsdsgiitsdapvhncdtrcqtphgalnsslpfqnvhpitige cpkyvkstklrmatglrnvpsr
Timeline for d2wrhj_: