Lineage for d1riea_ (1rie A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1120372Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 1120373Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 1120374Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)
  6. 1120397Protein ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain [50024] (3 species)
  7. 1120418Species Cow (Bos taurus) [TaxId:9913] [50025] (10 PDB entries)
  8. 1120419Domain d1riea_: 1rie A: [24427]
    complexed with fes

Details for d1riea_

PDB Entry: 1rie (more details), 1.5 Å

PDB Description: structure of a water soluble fragment of the rieske iron-sulfur protein of the bovine heart mitochondrial cytochrome bc1-complex
PDB Compounds: (A:) Rieske iron-sulfur protein

SCOPe Domain Sequences for d1riea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1riea_ b.33.1.1 (A:) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Cow (Bos taurus) [TaxId: 9913]}
amskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdpqhdlervkk
pewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnlevpsyefts
ddmvivg

SCOPe Domain Coordinates for d1riea_:

Click to download the PDB-style file with coordinates for d1riea_.
(The format of our PDB-style files is described here.)

Timeline for d1riea_: