SCOPe 2.06: Domain d2wrhi_: 2wrh I:

Lineage for d2wrhi_ (2wrh I:)

1. Root: SCOPe 2.06

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (34 species)
   not a true protein

7. Species Influenza a virus (a/mallard/alberta/35/1976(h1n1)) [TaxId:352520] [255663] (1 PDB entry)

8. Domain d2wrhi_: 2wrh I: [244269]
   Other proteins in same PDB: d2wrhh_, d2wrhj_, d2wrhl_
   automated match to d1rd8b_
   complexed with sia

Details for d2wrhi_

PDB Entry: 2wrh, 3 Å

PDB Description: structure of h1 duck albert hemagglutinin with human receptor

PDB Compounds: (I:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d2wrhi_:

Sequence; same for both SEQRES and ATOM records:

>d2wrhi_ h.3.1.1 (I:) automated matches {Influenza a virus (a/mallard/alberta/35/1976(h1n1)) [TaxId: 352520]}
glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitskvnsviekmn
tqftavgkefnnlerrienlnkkvddgfldvwtynaellvllenertldfhdsnvrnlye
kvksqlrnnakeigngcfefyhkcddecmesvkngtydyp

Timeline for d2wrhi_:

• d2wrhi_ first appeared in SCOPe 2.04
  
• d2wrhi_ appears in SCOPe 2.05
  
• d2wrhi_ appears in SCOPe 2.07
  
• d2wrhi_ appears in the current release, SCOPe 2.08