Lineage for d2wrhh_ (2wrh H:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778135Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1778497Protein automated matches [190291] (24 species)
    not a true protein
  7. 1778529Species Influenza a virus (a/mallard/alberta/35/1976(h1n1)) [TaxId:352520] [255664] (1 PDB entry)
  8. 1778530Domain d2wrhh_: 2wrh H: [244268]
    Other proteins in same PDB: d2wrhi_, d2wrhk_, d2wrhm_
    automated match to d1rd8a_
    complexed with sia

Details for d2wrhh_

PDB Entry: 2wrh (more details), 3 Å

PDB Description: structure of h1 duck albert hemagglutinin with human receptor
PDB Compounds: (H:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d2wrhh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wrhh_ b.19.1.2 (H:) automated matches {Influenza a virus (a/mallard/alberta/35/1976(h1n1)) [TaxId: 352520]}
dticvgyhannstdtvdtvleknvtvthsvnlledshngklcslgiaplqlgkcnvagwl
lgnpecdllltanswsyiietsnsengtcypgefidyeelreqlssvssfekfeifpkas
swpnhetkgvtaacsysgassfyrnllwitkkgtsypklsksytnnkgkevlvlwgvhhp
psvseqqslyqnadayvsvgsskynrrfapeiaarpkvrgqagrmnyywtlldqgdtitf
eatgnliapwyafalnkgsdsgiitsdapvhncdtrcqtphgalnsslpfqnvhpitige
cpkyvkstklrmatglrnvpsr

SCOPe Domain Coordinates for d2wrhh_:

Click to download the PDB-style file with coordinates for d2wrhh_.
(The format of our PDB-style files is described here.)

Timeline for d2wrhh_: