SCOPe 2.05: Domain d2wrhh_: 2wrh H:

Lineage for d2wrhh_ (2wrh H:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein automated matches [190291] (24 species)
   not a true protein

7. Species Influenza a virus (a/mallard/alberta/35/1976(h1n1)) [TaxId:352520] [255664] (1 PDB entry)

8. Domain d2wrhh_: 2wrh H: [244268]
   Other proteins in same PDB: d2wrhi_, d2wrhk_, d2wrhm_
   automated match to d1rd8a_
   complexed with sia

Details for d2wrhh_

PDB Entry: 2wrh, 3 Å

PDB Description: structure of h1 duck albert hemagglutinin with human receptor

PDB Compounds: (H:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d2wrhh_:

Sequence; same for both SEQRES and ATOM records:

>d2wrhh_ b.19.1.2 (H:) automated matches {Influenza a virus (a/mallard/alberta/35/1976(h1n1)) [TaxId: 352520]}
dticvgyhannstdtvdtvleknvtvthsvnlledshngklcslgiaplqlgkcnvagwl
lgnpecdllltanswsyiietsnsengtcypgefidyeelreqlssvssfekfeifpkas
swpnhetkgvtaacsysgassfyrnllwitkkgtsypklsksytnnkgkevlvlwgvhhp
psvseqqslyqnadayvsvgsskynrrfapeiaarpkvrgqagrmnyywtlldqgdtitf
eatgnliapwyafalnkgsdsgiitsdapvhncdtrcqtphgalnsslpfqnvhpitige
cpkyvkstklrmatglrnvpsr

Timeline for d2wrhh_:

• d2wrhh_ first appeared in SCOPe 2.04
  
• d2wrhh_ appears in SCOPe 2.06
  
• d2wrhh_ appears in the current release, SCOPe 2.08