Lineage for d2wrgl_ (2wrg L:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1531182Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1531183Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1531228Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1531229Protein Hemagglutinin [49824] (6 species)
    includes rudiment esterase domain
  7. 1531230Species Influenza a virus (a/brevig mission/1/1918(h1n1)) [TaxId:88776] [188803] (6 PDB entries)
  8. 1531240Domain d2wrgl_: 2wrg L: [244266]
    Other proteins in same PDB: d2wrgi_, d2wrgk_, d2wrgm_
    automated match to d1rd8a_
    complexed with nag

Details for d2wrgl_

PDB Entry: 2wrg (more details), 3 Å

PDB Description: structure of h1 1918 hemagglutinin with human receptor
PDB Compounds: (L:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d2wrgl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wrgl_ b.19.1.2 (L:) Hemagglutinin {Influenza a virus (a/brevig mission/1/1918(h1n1)) [TaxId: 88776]}
dticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcniagw
llgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfeifpkt
sswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvlwgvh
hpptgtdqqslyqnadayvsvgsskynrrftpeiaarpkvrdqagrmnyywtllepgdti
tfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnihpvti
gecpkyvrstklrmatglrnipsrq

SCOPe Domain Coordinates for d2wrgl_:

Click to download the PDB-style file with coordinates for d2wrgl_.
(The format of our PDB-style files is described here.)

Timeline for d2wrgl_: