Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (34 species) not a true protein |
Species Influenza a virus (a/brevig mission/1/1918(h1n1)) [TaxId:88776] [255662] (1 PDB entry) |
Domain d2wrgk_: 2wrg K: [244265] Other proteins in same PDB: d2wrgh_, d2wrgj_, d2wrgl_ automated match to d1rd8b_ complexed with nag |
PDB Entry: 2wrg (more details), 3 Å
SCOPe Domain Sequences for d2wrgk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wrgk_ h.3.1.1 (K:) automated matches {Influenza a virus (a/brevig mission/1/1918(h1n1)) [TaxId: 88776]} glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye kvksqlknnakeigngcfefyhkcddacmesvrngtydypk
Timeline for d2wrgk_: