Lineage for d2wrgk_ (2wrg K:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969953Protein automated matches [254646] (33 species)
    not a true protein
  7. 1969956Species Influenza a virus (a/brevig mission/1/1918(h1n1)) [TaxId:88776] [255662] (1 PDB entry)
  8. 1969958Domain d2wrgk_: 2wrg K: [244265]
    Other proteins in same PDB: d2wrgh_, d2wrgj_, d2wrgl_
    automated match to d1rd8b_
    complexed with nag

Details for d2wrgk_

PDB Entry: 2wrg (more details), 3 Å

PDB Description: structure of h1 1918 hemagglutinin with human receptor
PDB Compounds: (K:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d2wrgk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wrgk_ h.3.1.1 (K:) automated matches {Influenza a virus (a/brevig mission/1/1918(h1n1)) [TaxId: 88776]}
glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
kvksqlknnakeigngcfefyhkcddacmesvrngtydypk

SCOPe Domain Coordinates for d2wrgk_:

Click to download the PDB-style file with coordinates for d2wrgk_.
(The format of our PDB-style files is described here.)

Timeline for d2wrgk_: