Lineage for d2wrgj_ (2wrg J:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2775522Protein Hemagglutinin [49824] (22 species)
    includes rudiment esterase domain
  7. 2775523Species Influenza A virus (a/brevig mission/1/1918(h1n1)) [TaxId:88776] [188803] (5 PDB entries)
  8. 2775535Domain d2wrgj_: 2wrg J: [244264]
    Other proteins in same PDB: d2wrgi_, d2wrgk_, d2wrgm_
    automated match to d1rd8a_
    complexed with nag

Details for d2wrgj_

PDB Entry: 2wrg (more details), 3 Å

PDB Description: structure of h1 1918 hemagglutinin with human receptor
PDB Compounds: (J:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d2wrgj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wrgj_ b.19.1.2 (J:) Hemagglutinin {Influenza A virus (a/brevig mission/1/1918(h1n1)) [TaxId: 88776]}
dticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcniagw
llgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfeifpkt
sswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvlwgvh
hpptgtdqqslyqnadayvsvgsskynrrftpeiaarpkvrdqagrmnyywtllepgdti
tfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnihpvti
gecpkyvrstklrmatglrnipsrq

SCOPe Domain Coordinates for d2wrgj_:

Click to download the PDB-style file with coordinates for d2wrgj_.
(The format of our PDB-style files is described here.)

Timeline for d2wrgj_: