SCOPe 2.05: Domain d2wrgi_: 2wrg I:

Lineage for d2wrgi_ (2wrg I:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (33 species)
   not a true protein

7. Species Influenza a virus (a/brevig mission/1/1918(h1n1)) [TaxId:88776] [255662] (1 PDB entry)

8. Domain d2wrgi_: 2wrg I: [244263]
   Other proteins in same PDB: d2wrgh_, d2wrgj_, d2wrgl_
   automated match to d1rd8b_
   complexed with nag

Details for d2wrgi_

PDB Entry: 2wrg, 3 Å

PDB Description: structure of h1 1918 hemagglutinin with human receptor

PDB Compounds: (I:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d2wrgi_:

Sequence; same for both SEQRES and ATOM records:

>d2wrgi_ h.3.1.1 (I:) automated matches {Influenza a virus (a/brevig mission/1/1918(h1n1)) [TaxId: 88776]}
glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
kvksqlknnakeigngcfefyhkcddacmesvrngtydypk

Timeline for d2wrgi_:

• d2wrgi_ first appeared in SCOPe 2.04
  
• d2wrgi_ appears in SCOPe 2.06
  
• d2wrgi_ appears in the current release, SCOPe 2.08