Lineage for d2wrgh_ (2wrg H:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2047495Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2047496Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2047543Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2047544Protein Hemagglutinin [49824] (9 species)
    includes rudiment esterase domain
  7. 2047545Species Influenza a virus (a/brevig mission/1/1918(h1n1)) [TaxId:88776] [188803] (3 PDB entries)
  8. 2047550Domain d2wrgh_: 2wrg H: [244262]
    Other proteins in same PDB: d2wrgi_, d2wrgk_, d2wrgm_
    automated match to d1rd8a_
    complexed with nag

Details for d2wrgh_

PDB Entry: 2wrg (more details), 3 Å

PDB Description: structure of h1 1918 hemagglutinin with human receptor
PDB Compounds: (H:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d2wrgh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wrgh_ b.19.1.2 (H:) Hemagglutinin {Influenza a virus (a/brevig mission/1/1918(h1n1)) [TaxId: 88776]}
dticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcniagw
llgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfeifpkt
sswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvlwgvh
hpptgtdqqslyqnadayvsvgsskynrrftpeiaarpkvrdqagrmnyywtllepgdti
tfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnihpvti
gecpkyvrstklrmatglrnipsrq

SCOPe Domain Coordinates for d2wrgh_:

Click to download the PDB-style file with coordinates for d2wrgh_.
(The format of our PDB-style files is described here.)

Timeline for d2wrgh_: