SCOPe 2.08: Domain d2wrfi2: 2wrf I:330-496

Lineage for d2wrfi2 (2wrf I:330-496)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.0: automated matches [254278] (1 protein)
   not a true family

6. Protein automated matches [254645] (42 species)
   not a true protein

7. Species Influenza A virus (a/chicken/potsdam/4705/1984(h2n2)) [TaxId:139280] [255661] (1 PDB entry)

8. Domain d2wrfi2: 2wrf I:330-496 [244261]
   Other proteins in same PDB: d2wrfa1, d2wrfb1, d2wrfc1, d2wrfd1, d2wrfe1, d2wrff1, d2wrfg1, d2wrfh1, d2wrfi1
   automated match to d1ha0a2
   complexed with sia

Details for d2wrfi2

PDB Entry: 2wrf, 3.1 Å

PDB Description: structure of h2 avian jena hemagglutinin with human receptor

PDB Compounds: (I:) Hemagglutinin

SCOPe Domain Sequences for d2wrfi2:

Sequence; same for both SEQRES and ATOM records:

>d2wrfi2 h.3.1.0 (I:330-496) automated matches {Influenza A virus (a/chicken/potsdam/4705/1984(h2n2)) [TaxId: 139280]}
glfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestqkafdgitnkvnsviekmn
tqfeavgkefsnlekrlenlnkkmedgfldvwtynaellvlmenemtldfhdsnvknlyd
kvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydyskyeeesk

Timeline for d2wrfi2:

• d2wrfi2 first appeared in SCOPe 2.04
  
• d2wrfi2 appears in SCOPe 2.07