![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
![]() | Protein automated matches [227017] (14 species) not a true protein |
![]() | Species Influenza a virus (a/chicken/potsdam/4705/1984(h2n2)) [TaxId:139280] [255660] (1 PDB entry) |
![]() | Domain d2wrfi1: 2wrf I:7-325 [244260] Other proteins in same PDB: d2wrfa2, d2wrfb2, d2wrfc2, d2wrfd2, d2wrfe2, d2wrff2, d2wrfg2, d2wrfh2, d2wrfi2 automated match to d1ha0a1 complexed with sia |
PDB Entry: 2wrf (more details), 3.1 Å
SCOPe Domain Sequences for d2wrfi1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wrfi1 b.19.1.0 (I:7-325) automated matches {Influenza a virus (a/chicken/potsdam/4705/1984(h2n2)) [TaxId: 139280]} icvgyhsnnstekvdtilernvtvthaqdilekthngklcklngipplelgdcsiagwll gnpecdrlltvpewsyimekenprnglcypgsfndyeelkhlissvthfekvkilpkdrw tqhtttggsqgcavfdnpsffrnmvwltkkgsnypvakgsynntsgeqmliiwgvhhpnd eteqrtlyqnvgayvsvgtstlnkrslpeiatrpevngqggrmefswtildiwdtinfes tgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnihpltigecp kyvkserlvlatglrnvpq
Timeline for d2wrfi1: