Lineage for d1qexb_ (1qex B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58220Fold b.32: gp9 [50016] (1 superfamily)
  4. 58221Superfamily b.32.1: gp9 [50017] (1 family) (S)
  5. 58222Family b.32.1.1: gp9 [50018] (1 protein)
  6. 58223Protein gp9 [50019] (1 species)
  7. 58224Species Bacteriophage T4 [TaxId:10665] [50020] (1 PDB entry)
  8. 58226Domain d1qexb_: 1qex B: [24426]

Details for d1qexb_

PDB Entry: 1qex (more details), 2.3 Å

PDB Description: bacteriophage t4 gene product 9 (gp9), the trigger of tail contraction and the long tail fibers connector

SCOP Domain Sequences for d1qexb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qexb_ b.32.1.1 (B:) gp9 {Bacteriophage T4}
mfiqepkklidtgeignastgdilfdggnkinsdfnaiynafgdqrkmavangtgadgqi
ihatgyyqkhsiteyatpvkvgtrhdidtstvgvkviiergelgdcvefinsngsisvtn
pltiqaidsikgvsgnlvvtspyskvtlrcissdnstsvwnysiesmfgqkespaegtwn
istsgsvdiplfhrteynmakllvtcqsvdgrkiktaeinilvdtvnsevisseyavmrv
gneteedeianiafsikenyvtatissstvgmraavkviatqkigvaq

SCOP Domain Coordinates for d1qexb_:

Click to download the PDB-style file with coordinates for d1qexb_.
(The format of our PDB-style files is described here.)

Timeline for d1qexb_: