Lineage for d2wrfh2 (2wrf H:330-496)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2646381Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2646382Protein automated matches [254645] (42 species)
    not a true protein
  7. 2646416Species Influenza A virus (a/chicken/potsdam/4705/1984(h2n2)) [TaxId:139280] [255661] (1 PDB entry)
  8. 2646424Domain d2wrfh2: 2wrf H:330-496 [244259]
    Other proteins in same PDB: d2wrfa1, d2wrfb1, d2wrfc1, d2wrfd1, d2wrfe1, d2wrff1, d2wrfg1, d2wrfh1, d2wrfi1
    automated match to d1ha0a2
    complexed with sia

Details for d2wrfh2

PDB Entry: 2wrf (more details), 3.1 Å

PDB Description: structure of h2 avian jena hemagglutinin with human receptor
PDB Compounds: (H:) Hemagglutinin

SCOPe Domain Sequences for d2wrfh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wrfh2 h.3.1.0 (H:330-496) automated matches {Influenza A virus (a/chicken/potsdam/4705/1984(h2n2)) [TaxId: 139280]}
glfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestqkafdgitnkvnsviekmn
tqfeavgkefsnlekrlenlnkkmedgfldvwtynaellvlmenemtldfhdsnvknlyd
kvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydyskyeeesk

SCOPe Domain Coordinates for d2wrfh2:

Click to download the PDB-style file with coordinates for d2wrfh2.
(The format of our PDB-style files is described here.)

Timeline for d2wrfh2: