Lineage for d2wrfh1 (2wrf H:7-325)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385894Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2385895Protein automated matches [227017] (57 species)
    not a true protein
  7. 2385927Species Influenza A virus (a/chicken/potsdam/4705/1984(h2n2)) [TaxId:139280] [255660] (1 PDB entry)
  8. 2385935Domain d2wrfh1: 2wrf H:7-325 [244258]
    Other proteins in same PDB: d2wrfa2, d2wrfb2, d2wrfc2, d2wrfd2, d2wrfe2, d2wrff2, d2wrfg2, d2wrfh2, d2wrfi2
    automated match to d1ha0a1
    complexed with sia

Details for d2wrfh1

PDB Entry: 2wrf (more details), 3.1 Å

PDB Description: structure of h2 avian jena hemagglutinin with human receptor
PDB Compounds: (H:) Hemagglutinin

SCOPe Domain Sequences for d2wrfh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wrfh1 b.19.1.0 (H:7-325) automated matches {Influenza A virus (a/chicken/potsdam/4705/1984(h2n2)) [TaxId: 139280]}
icvgyhsnnstekvdtilernvtvthaqdilekthngklcklngipplelgdcsiagwll
gnpecdrlltvpewsyimekenprnglcypgsfndyeelkhlissvthfekvkilpkdrw
tqhtttggsqgcavfdnpsffrnmvwltkkgsnypvakgsynntsgeqmliiwgvhhpnd
eteqrtlyqnvgayvsvgtstlnkrslpeiatrpevngqggrmefswtildiwdtinfes
tgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnihpltigecp
kyvkserlvlatglrnvpq

SCOPe Domain Coordinates for d2wrfh1:

Click to download the PDB-style file with coordinates for d2wrfh1.
(The format of our PDB-style files is described here.)

Timeline for d2wrfh1: