Lineage for d2wrff2 (2wrf F:330-496)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1709414Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1709415Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1709924Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 1709925Protein automated matches [254645] (6 species)
    not a true protein
  7. 1709928Species Influenza a virus (a/chicken/potsdam/4705/1984(h2n2)) [TaxId:139280] [255661] (1 PDB entry)
  8. 1709934Domain d2wrff2: 2wrf F:330-496 [244255]
    Other proteins in same PDB: d2wrfa1, d2wrfb1, d2wrfc1, d2wrfd1, d2wrfe1, d2wrff1, d2wrfg1, d2wrfh1, d2wrfi1
    automated match to d1ha0a2
    complexed with sia

Details for d2wrff2

PDB Entry: 2wrf (more details), 3.1 Å

PDB Description: structure of h2 avian jena hemagglutinin with human receptor
PDB Compounds: (F:) Hemagglutinin

SCOPe Domain Sequences for d2wrff2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wrff2 h.3.1.0 (F:330-496) automated matches {Influenza a virus (a/chicken/potsdam/4705/1984(h2n2)) [TaxId: 139280]}
glfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestqkafdgitnkvnsviekmn
tqfeavgkefsnlekrlenlnkkmedgfldvwtynaellvlmenemtldfhdsnvknlyd
kvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydyskyeeesk

SCOPe Domain Coordinates for d2wrff2:

Click to download the PDB-style file with coordinates for d2wrff2.
(The format of our PDB-style files is described here.)

Timeline for d2wrff2: