Lineage for d2wrff1 (2wrf F:7-325)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778695Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 1778696Protein automated matches [227017] (23 species)
    not a true protein
  7. 1778725Species Influenza a virus (a/chicken/potsdam/4705/1984(h2n2)) [TaxId:139280] [255660] (1 PDB entry)
  8. 1778731Domain d2wrff1: 2wrf F:7-325 [244254]
    Other proteins in same PDB: d2wrfa2, d2wrfb2, d2wrfc2, d2wrfd2, d2wrfe2, d2wrff2, d2wrfg2, d2wrfh2, d2wrfi2
    automated match to d1ha0a1
    complexed with sia

Details for d2wrff1

PDB Entry: 2wrf (more details), 3.1 Å

PDB Description: structure of h2 avian jena hemagglutinin with human receptor
PDB Compounds: (F:) Hemagglutinin

SCOPe Domain Sequences for d2wrff1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wrff1 b.19.1.0 (F:7-325) automated matches {Influenza a virus (a/chicken/potsdam/4705/1984(h2n2)) [TaxId: 139280]}
icvgyhsnnstekvdtilernvtvthaqdilekthngklcklngipplelgdcsiagwll
gnpecdrlltvpewsyimekenprnglcypgsfndyeelkhlissvthfekvkilpkdrw
tqhtttggsqgcavfdnpsffrnmvwltkkgsnypvakgsynntsgeqmliiwgvhhpnd
eteqrtlyqnvgayvsvgtstlnkrslpeiatrpevngqggrmefswtildiwdtinfes
tgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnihpltigecp
kyvkserlvlatglrnvpq

SCOPe Domain Coordinates for d2wrff1:

Click to download the PDB-style file with coordinates for d2wrff1.
(The format of our PDB-style files is described here.)

Timeline for d2wrff1: