SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2wrff1 (2wrf F:7-325)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040896Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2040897Protein automated matches [227017] (27 species)
    not a true protein
  7. 2040926Species Influenza a virus (a/chicken/potsdam/4705/1984(h2n2)) [TaxId:139280] [255660] (1 PDB entry)
  8. 2040932Domain d2wrff1: 2wrf F:7-325 [244254]
    Other proteins in same PDB: d2wrfa2, d2wrfb2, d2wrfc2, d2wrfd2, d2wrfe2, d2wrff2, d2wrfg2, d2wrfh2, d2wrfi2
    automated match to d1ha0a1
    complexed with sia

Details for d2wrff1

PDB Entry: 2wrf (more details), 3.1 Å

PDB Description: structure of h2 avian jena hemagglutinin with human receptor
PDB Compounds: (F:) Hemagglutinin

SCOPe Domain Sequences for d2wrff1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wrff1 b.19.1.0 (F:7-325) automated matches {Influenza a virus (a/chicken/potsdam/4705/1984(h2n2)) [TaxId: 139280]}
icvgyhsnnstekvdtilernvtvthaqdilekthngklcklngipplelgdcsiagwll
gnpecdrlltvpewsyimekenprnglcypgsfndyeelkhlissvthfekvkilpkdrw
tqhtttggsqgcavfdnpsffrnmvwltkkgsnypvakgsynntsgeqmliiwgvhhpnd
eteqrtlyqnvgayvsvgtstlnkrslpeiatrpevngqggrmefswtildiwdtinfes
tgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnihpltigecp
kyvkserlvlatglrnvpq

SCOPe Domain Coordinates for d2wrff1:

Click to download the PDB-style file with coordinates for d2wrff1.
(The format of our PDB-style files is described here.)

Timeline for d2wrff1: