Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.0: automated matches [254278] (1 protein) not a true family |
Protein automated matches [254645] (42 species) not a true protein |
Species Influenza A virus (a/chicken/potsdam/4705/1984(h2n2)) [TaxId:139280] [255661] (1 PDB entry) |
Domain d2wrfe2: 2wrf E:330-496 [244253] Other proteins in same PDB: d2wrfa1, d2wrfb1, d2wrfc1, d2wrfd1, d2wrfe1, d2wrff1, d2wrfg1, d2wrfh1, d2wrfi1 automated match to d1ha0a2 complexed with sia |
PDB Entry: 2wrf (more details), 3.1 Å
SCOPe Domain Sequences for d2wrfe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wrfe2 h.3.1.0 (E:330-496) automated matches {Influenza A virus (a/chicken/potsdam/4705/1984(h2n2)) [TaxId: 139280]} glfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestqkafdgitnkvnsviekmn tqfeavgkefsnlekrlenlnkkmedgfldvwtynaellvlmenemtldfhdsnvknlyd kvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydyskyeeesk
Timeline for d2wrfe2: