Lineage for d1qexa_ (1qex A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13005Fold b.32: gp9 [50016] (1 superfamily)
  4. 13006Superfamily b.32.1: gp9 [50017] (1 family) (S)
  5. 13007Family b.32.1.1: gp9 [50018] (1 protein)
  6. 13008Protein gp9 [50019] (1 species)
  7. 13009Species Bacteriophage T4 [TaxId:10665] [50020] (1 PDB entry)
  8. 13010Domain d1qexa_: 1qex A: [24425]

Details for d1qexa_

PDB Entry: 1qex (more details), 2.3 Å

PDB Description: bacteriophage t4 gene product 9 (gp9), the trigger of tail contraction and the long tail fibers connector

SCOP Domain Sequences for d1qexa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qexa_ b.32.1.1 (A:) gp9 {Bacteriophage T4}
mfiqepkklidtgeignastgdilfdggnkinsdfnaiynafgdqrkmavangtgadgqi
ihatgyyqkhsiteyatpvkvgtrhdidtstvgvkviiergelgdcvefinsngsisvtn
pltiqaidsikgvsgnlvvtspyskvtlrcissdnstsvwnysiesmfgqkespaegtwn
istsgsvdiplfhrteynmakllvtcqsvdgrkiktaeinilvdtvnsevisseyavmrv
gneteedeianiafsikenyvtatissstvgmraavkviatqkigvaq

SCOP Domain Coordinates for d1qexa_:

Click to download the PDB-style file with coordinates for d1qexa_.
(The format of our PDB-style files is described here.)

Timeline for d1qexa_: