Lineage for d1qexa_ (1qex A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782306Fold b.32: gp9 [50016] (1 superfamily)
    consists of two different beta-sandwich domains unrelated to other beta-sandwich folds
  4. 2782307Superfamily b.32.1: gp9 [50017] (1 family) (S)
    automatically mapped to Pfam PF07880
  5. 2782308Family b.32.1.1: gp9 [50018] (1 protein)
  6. 2782309Protein gp9 [50019] (1 species)
    the trigger of tail contraction and the long tail fibers connector
  7. 2782310Species Bacteriophage T4 [TaxId:10665] [50020] (3 PDB entries)
  8. 2782313Domain d1qexa_: 1qex A: [24425]
    complexed with epe

Details for d1qexa_

PDB Entry: 1qex (more details), 2.3 Å

PDB Description: bacteriophage t4 gene product 9 (gp9), the trigger of tail contraction and the long tail fibers connector
PDB Compounds: (A:) protein (bacteriophage t4 gene product 9 (gp9))

SCOPe Domain Sequences for d1qexa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qexa_ b.32.1.1 (A:) gp9 {Bacteriophage T4 [TaxId: 10665]}
mfiqepkklidtgeignastgdilfdggnkinsdfnaiynafgdqrkmavangtgadgqi
ihatgyyqkhsiteyatpvkvgtrhdidtstvgvkviiergelgdcvefinsngsisvtn
pltiqaidsikgvsgnlvvtspyskvtlrcissdnstsvwnysiesmfgqkespaegtwn
istsgsvdiplfhrteynmakllvtcqsvdgrkiktaeinilvdtvnsevisseyavmrv
gneteedeianiafsikenyvtatissstvgmraavkviatqkigvaq

SCOPe Domain Coordinates for d1qexa_:

Click to download the PDB-style file with coordinates for d1qexa_.
(The format of our PDB-style files is described here.)

Timeline for d1qexa_: