SCOPe 2.07: Domain d2wrfc1: 2wrf C:7-325

Lineage for d2wrfc1 (2wrf C:7-325)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (57 species)
   not a true protein

7. Species Influenza A virus (a/chicken/potsdam/4705/1984(h2n2)) [TaxId:139280] [255660] (1 PDB entry)

8. Domain d2wrfc1: 2wrf C:7-325 [244248]
   Other proteins in same PDB: d2wrfa2, d2wrfb2, d2wrfc2, d2wrfd2, d2wrfe2, d2wrff2, d2wrfg2, d2wrfh2, d2wrfi2
   automated match to d1ha0a1
   complexed with sia

Details for d2wrfc1

PDB Entry: 2wrf, 3.1 Å

PDB Description: structure of h2 avian jena hemagglutinin with human receptor

PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d2wrfc1:

Sequence; same for both SEQRES and ATOM records:

>d2wrfc1 b.19.1.0 (C:7-325) automated matches {Influenza A virus (a/chicken/potsdam/4705/1984(h2n2)) [TaxId: 139280]}
icvgyhsnnstekvdtilernvtvthaqdilekthngklcklngipplelgdcsiagwll
gnpecdrlltvpewsyimekenprnglcypgsfndyeelkhlissvthfekvkilpkdrw
tqhtttggsqgcavfdnpsffrnmvwltkkgsnypvakgsynntsgeqmliiwgvhhpnd
eteqrtlyqnvgayvsvgtstlnkrslpeiatrpevngqggrmefswtildiwdtinfes
tgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnihpltigecp
kyvkserlvlatglrnvpq

Timeline for d2wrfc1:

• d2wrfc1 first appeared in SCOPe 2.04
  
• d2wrfc1 appears in SCOPe 2.06
  
• d2wrfc1 appears in the current release, SCOPe 2.08