Lineage for d2wrec2 (2wre C:330-493)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2267706Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2267707Protein automated matches [254645] (23 species)
    not a true protein
  7. 2267746Species Influenza a virus (a/japan/305+/1957(h2n2)) [TaxId:382813] [255659] (2 PDB entries)
  8. 2267749Domain d2wrec2: 2wre C:330-493 [244243]
    Other proteins in same PDB: d2wrea1, d2wreb1, d2wrec1
    automated match to d1ha0a2

Details for d2wrec2

PDB Entry: 2wre (more details), 3 Å

PDB Description: structure of h2 japan hemagglutinin with human receptor
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d2wrec2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wrec2 h.3.1.0 (C:330-493) automated matches {Influenza a virus (a/japan/305+/1957(h2n2)) [TaxId: 382813]}
glfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestqkafdgitnkvnsviekmn
tqfeavgkefsnlerrlenlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydypkyee

SCOPe Domain Coordinates for d2wrec2:

Click to download the PDB-style file with coordinates for d2wrec2.
(The format of our PDB-style files is described here.)

Timeline for d2wrec2: