Lineage for d2wreb2 (2wre B:330-494)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3041799Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 3041800Protein automated matches [254645] (42 species)
    not a true protein
  7. 3041879Species Influenza A virus (a/japan/305+/1957(h2n2)) [TaxId:382813] [255659] (2 PDB entries)
  8. 3041881Domain d2wreb2: 2wre B:330-494 [244241]
    Other proteins in same PDB: d2wrea1, d2wreb1, d2wrec1
    automated match to d1ha0a2

Details for d2wreb2

PDB Entry: 2wre (more details), 3 Å

PDB Description: structure of h2 japan hemagglutinin with human receptor
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d2wreb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wreb2 h.3.1.0 (B:330-494) automated matches {Influenza A virus (a/japan/305+/1957(h2n2)) [TaxId: 382813]}
glfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestqkafdgitnkvnsviekmn
tqfeavgkefsnlerrlenlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydypkyeee

SCOPe Domain Coordinates for d2wreb2:

Click to download the PDB-style file with coordinates for d2wreb2.
(The format of our PDB-style files is described here.)

Timeline for d2wreb2: