Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.0: automated matches [254278] (1 protein) not a true family |
Protein automated matches [254645] (42 species) not a true protein |
Species Influenza A virus (a/japan/305+/1957(h2n2)) [TaxId:382813] [255659] (2 PDB entries) |
Domain d2wrea2: 2wre A:330-493 [244239] Other proteins in same PDB: d2wrea1, d2wreb1, d2wrec1 automated match to d1ha0a2 |
PDB Entry: 2wre (more details), 3 Å
SCOPe Domain Sequences for d2wrea2:
Sequence, based on SEQRES records: (download)
>d2wrea2 h.3.1.0 (A:330-493) automated matches {Influenza A virus (a/japan/305+/1957(h2n2)) [TaxId: 382813]} glfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestqkafdgitnkvnsviekmn tqfeavgkefsnlerrlenlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd kvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydypkyee
>d2wrea2 h.3.1.0 (A:330-493) automated matches {Influenza A virus (a/japan/305+/1957(h2n2)) [TaxId: 382813]} glfgaiagfieggwqgmvdgwygyhadkestqkafdgitnkvnsviekmntqfeavgkef snlerrlenlnkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrmqlrdnv kelgngcfefyhkcddecmnsvkngtydypkyee
Timeline for d2wrea2:
View in 3D Domains from other chains: (mouse over for more information) d2wreb1, d2wreb2, d2wrec1, d2wrec2 |