Lineage for d2wrea2 (2wre A:330-493)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2592334Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2592335Protein automated matches [254645] (35 species)
    not a true protein
  7. 2592394Species Influenza A virus (a/japan/305+/1957(h2n2)) [TaxId:382813] [255659] (2 PDB entries)
  8. 2592395Domain d2wrea2: 2wre A:330-493 [244239]
    Other proteins in same PDB: d2wrea1, d2wreb1, d2wrec1
    automated match to d1ha0a2

Details for d2wrea2

PDB Entry: 2wre (more details), 3 Å

PDB Description: structure of h2 japan hemagglutinin with human receptor
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d2wrea2:

Sequence, based on SEQRES records: (download)

>d2wrea2 h.3.1.0 (A:330-493) automated matches {Influenza A virus (a/japan/305+/1957(h2n2)) [TaxId: 382813]}
glfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestqkafdgitnkvnsviekmn
tqfeavgkefsnlerrlenlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydypkyee

Sequence, based on observed residues (ATOM records): (download)

>d2wrea2 h.3.1.0 (A:330-493) automated matches {Influenza A virus (a/japan/305+/1957(h2n2)) [TaxId: 382813]}
glfgaiagfieggwqgmvdgwygyhadkestqkafdgitnkvnsviekmntqfeavgkef
snlerrlenlnkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrmqlrdnv
kelgngcfefyhkcddecmnsvkngtydypkyee

SCOPe Domain Coordinates for d2wrea2:

Click to download the PDB-style file with coordinates for d2wrea2.
(The format of our PDB-style files is described here.)

Timeline for d2wrea2: