Lineage for d2wrea1 (2wre A:8-325)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040896Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2040897Protein automated matches [227017] (33 species)
    not a true protein
  7. 2040936Species Influenza a virus (a/japan/305+/1957(h2n2)) [TaxId:382813] [255658] (2 PDB entries)
  8. 2040937Domain d2wrea1: 2wre A:8-325 [244238]
    Other proteins in same PDB: d2wrea2, d2wreb2, d2wrec2
    automated match to d1ha0a1

Details for d2wrea1

PDB Entry: 2wre (more details), 3 Å

PDB Description: structure of h2 japan hemagglutinin with human receptor
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d2wrea1:

Sequence, based on SEQRES records: (download)

>d2wrea1 b.19.1.0 (A:8-325) automated matches {Influenza a virus (a/japan/305+/1957(h2n2)) [TaxId: 382813]}
cigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsiagwllg
npecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilpkdrwt
qhtttggsqacavsgnpsffrnmvwltkkgsnypvakgsynntsgeqmliiwgvhhpide
keqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvnglgsrmefswtlldmwdtinfest
gnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhpltigecpk
yvkseklvlatglrnvpq

Sequence, based on observed residues (ATOM records): (download)

>d2wrea1 b.19.1.0 (A:8-325) automated matches {Influenza a virus (a/japan/305+/1957(h2n2)) [TaxId: 382813]}
cigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsiagwllg
npecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilpkdrwt
qhtttggsqacavsgnpsffrnmvltkkgsnypvakgsynntsgeqmliiwgvhhpidek
eqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvnglgsrmefswtlldmwdtinfestg
nliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhpltigecpky
vkseklvlatglrnvpq

SCOPe Domain Coordinates for d2wrea1:

Click to download the PDB-style file with coordinates for d2wrea1.
(The format of our PDB-style files is described here.)

Timeline for d2wrea1: