Class b: All beta proteins [48724] (177 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (34 species) not a true protein |
Species Influenza a virus (a/japan/305+/1957(h2n2)) [TaxId:382813] [255658] (2 PDB entries) |
Domain d2wrdb1: 2wrd B:5-325 [244234] Other proteins in same PDB: d2wrda2, d2wrdb2, d2wrdc2 automated match to d1ha0a1 |
PDB Entry: 2wrd (more details), 3 Å
SCOPe Domain Sequences for d2wrdb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wrdb1 b.19.1.0 (B:5-325) automated matches {Influenza a virus (a/japan/305+/1957(h2n2)) [TaxId: 382813]} dqicigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsiagw llgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilpkd rwtqhtttggsracavsgnpsffrnmvwltkkgsnypvakgsynntsgeqmliiwgvhhp idekeqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvnglgsrmefswtlldmwdtinf estgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhpltige cpkyvkseklvlatglrnvpq
Timeline for d2wrdb1:
View in 3D Domains from other chains: (mouse over for more information) d2wrda1, d2wrda2, d2wrdc1, d2wrdc2 |