SCOPe 2.06: Domain d2wrdb1: 2wrd B:5-325

Lineage for d2wrdb1 (2wrd B:5-325)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (34 species)
   not a true protein

7. Species Influenza a virus (a/japan/305+/1957(h2n2)) [TaxId:382813] [255658] (2 PDB entries)

8. Domain d2wrdb1: 2wrd B:5-325 [244234]
   Other proteins in same PDB: d2wrda2, d2wrdb2, d2wrdc2
   automated match to d1ha0a1

Details for d2wrdb1

PDB Entry: 2wrd, 3 Å

PDB Description: structure of h2 japan hemagglutinin

PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d2wrdb1:

Sequence; same for both SEQRES and ATOM records:

>d2wrdb1 b.19.1.0 (B:5-325) automated matches {Influenza a virus (a/japan/305+/1957(h2n2)) [TaxId: 382813]}
dqicigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsiagw
llgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilpkd
rwtqhtttggsracavsgnpsffrnmvwltkkgsnypvakgsynntsgeqmliiwgvhhp
idekeqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvnglgsrmefswtlldmwdtinf
estgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhpltige
cpkyvkseklvlatglrnvpq

Timeline for d2wrdb1:

• d2wrdb1 first appeared in SCOPe 2.04
  
• d2wrdb1 appears in SCOPe 2.05
  
• d2wrdb1 appears in SCOPe 2.07
  
• d2wrdb1 appears in the current release, SCOPe 2.08