Lineage for d2wrbc2 (2wrb C:330-462)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2646381Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2646382Protein automated matches [254645] (42 species)
    not a true protein
  7. 2646598Species Influenza A virus, different strains [TaxId:11320] [255657] (9 PDB entries)
  8. 2646613Domain d2wrbc2: 2wrb C:330-462 [244231]
    Other proteins in same PDB: d2wrba1, d2wrbb1, d2wrbc1
    automated match to d1ha0a2
    complexed with sia

Details for d2wrbc2

PDB Entry: 2wrb (more details), 3.1 Å

PDB Description: the structure of influenza h2 human singapore hemagglutinin with avian receptor
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d2wrbc2:

Sequence, based on SEQRES records: (download)

>d2wrbc2 h.3.1.0 (C:330-462) automated matches {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmidgwygyhhsndqgsgyaadkestqkafdgitnkvnsviekmn
tqfeavgkefsnlerrlenlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrmqlrdnvkel

Sequence, based on observed residues (ATOM records): (download)

>d2wrbc2 h.3.1.0 (C:330-462) automated matches {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmidgwygyaadkestqkafdgitnkvnsviekmntqfeavgkef
snlerrlenlnkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrmqlrdnv
kel

SCOPe Domain Coordinates for d2wrbc2:

Click to download the PDB-style file with coordinates for d2wrbc2.
(The format of our PDB-style files is described here.)

Timeline for d2wrbc2: