SCOPe 2.08: Domain d2wrbc2: 2wrb C:330-462

Lineage for d2wrbc2 (2wrb C:330-462)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.0: automated matches [254278] (1 protein)
   not a true family

6. Protein automated matches [254645] (42 species)
   not a true protein

7. Species Influenza A virus, different strains [TaxId:11320] [255657] (9 PDB entries)

8. Domain d2wrbc2: 2wrb C:330-462 [244231]
   Other proteins in same PDB: d2wrba1, d2wrbb1, d2wrbc1
   automated match to d1ha0a2
   complexed with sia

Details for d2wrbc2

PDB Entry: 2wrb, 3.1 Å

PDB Description: the structure of influenza h2 human singapore hemagglutinin with avian receptor

PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d2wrbc2:

Sequence, based on SEQRES records:

>d2wrbc2 h.3.1.0 (C:330-462) automated matches {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmidgwygyhhsndqgsgyaadkestqkafdgitnkvnsviekmn
tqfeavgkefsnlerrlenlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrmqlrdnvkel

Sequence, based on observed residues (ATOM records):

>d2wrbc2 h.3.1.0 (C:330-462) automated matches {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmidgwygyaadkestqkafdgitnkvnsviekmntqfeavgkef
snlerrlenlnkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrmqlrdnv
kel

Timeline for d2wrbc2:

• d2wrbc2 first appeared in SCOPe 2.04
  
• d2wrbc2 appears in SCOPe 2.07