Class b: All beta proteins [48724] (180 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (58 species) not a true protein |
Species Influenza A virus, different strains [TaxId:11320] [228462] (34 PDB entries) |
Domain d2wrbc1: 2wrb C:7-324 [244230] Other proteins in same PDB: d2wrba2, d2wrbb2, d2wrbc2 automated match to d1ha0a1 complexed with sia |
PDB Entry: 2wrb (more details), 3.1 Å
SCOPe Domain Sequences for d2wrbc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wrbc1 b.19.1.0 (C:7-324) automated matches {Influenza A virus, different strains [TaxId: 11320]} icigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsiagwll gnpecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilpkdrw tqhtttggsracavsgnpsffrnmvwltekgsnypvakgsynntsgeqmliiwgvhhpnd eteqrtlyqnvgtyvsvgtstlnkrstpdiatrpkvnglgsrmefswtlldmwdtinfes tgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhpltigecp kyvkseklvlatglrnvp
Timeline for d2wrbc1:
View in 3D Domains from other chains: (mouse over for more information) d2wrba1, d2wrba2, d2wrbb1, d2wrbb2 |