SCOPe 2.07: Domain d2wrbb2: 2wrb B:330-495

Lineage for d2wrbb2 (2wrb B:330-495)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.0: automated matches [254278] (1 protein)
   not a true family

6. Protein automated matches [254645] (42 species)
   not a true protein

7. Species Influenza A virus, different strains [TaxId:11320] [255657] (9 PDB entries)

8. Domain d2wrbb2: 2wrb B:330-495 [244229]
   Other proteins in same PDB: d2wrba1, d2wrbb1, d2wrbc1
   automated match to d1ha0a2
   complexed with sia

Details for d2wrbb2

PDB Entry: 2wrb, 3.1 Å

PDB Description: the structure of influenza h2 human singapore hemagglutinin with avian receptor

PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d2wrbb2:

Sequence; same for both SEQRES and ATOM records:

>d2wrbb2 h.3.1.0 (B:330-495) automated matches {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmidgwygyhhsndqgsgyaadkestqkafdgitnkvnsviekmn
tqfeavgkefsnlerrlenlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydypkyeees

Timeline for d2wrbb2:

• d2wrbb2 first appeared in SCOPe 2.04
  
• d2wrbb2 appears in SCOPe 2.06
  
• d2wrbb2 appears in the current release, SCOPe 2.08