Lineage for d2wrbb2 (2wrb B:330-495)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1970237Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 1970238Protein automated matches [254645] (10 species)
    not a true protein
  7. 1970267Species Influenza A virus [TaxId:11320] [255657] (7 PDB entries)
  8. 1970277Domain d2wrbb2: 2wrb B:330-495 [244229]
    Other proteins in same PDB: d2wrba1, d2wrbb1, d2wrbc1
    automated match to d1ha0a2
    complexed with sia

Details for d2wrbb2

PDB Entry: 2wrb (more details), 3.1 Å

PDB Description: the structure of influenza h2 human singapore hemagglutinin with avian receptor
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d2wrbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wrbb2 h.3.1.0 (B:330-495) automated matches {Influenza A virus [TaxId: 11320]}
glfgaiagfieggwqgmidgwygyhhsndqgsgyaadkestqkafdgitnkvnsviekmn
tqfeavgkefsnlerrlenlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydypkyeees

SCOPe Domain Coordinates for d2wrbb2:

Click to download the PDB-style file with coordinates for d2wrbb2.
(The format of our PDB-style files is described here.)

Timeline for d2wrbb2: