![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
![]() | Family h.3.1.0: automated matches [254278] (1 protein) not a true family |
![]() | Protein automated matches [254645] (10 species) not a true protein |
![]() | Species Influenza A virus [TaxId:11320] [255657] (7 PDB entries) |
![]() | Domain d2wrbb2: 2wrb B:330-495 [244229] Other proteins in same PDB: d2wrba1, d2wrbb1, d2wrbc1 automated match to d1ha0a2 complexed with sia |
PDB Entry: 2wrb (more details), 3.1 Å
SCOPe Domain Sequences for d2wrbb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wrbb2 h.3.1.0 (B:330-495) automated matches {Influenza A virus [TaxId: 11320]} glfgaiagfieggwqgmidgwygyhhsndqgsgyaadkestqkafdgitnkvnsviekmn tqfeavgkefsnlerrlenlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd kvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydypkyeees
Timeline for d2wrbb2:
![]() Domains from other chains: (mouse over for more information) d2wrba1, d2wrba2, d2wrbc1, d2wrbc2 |