SCOPe 2.08: Domain d2wrbb1: 2wrb B:5-324

Lineage for d2wrbb1 (2wrb B:5-324)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (58 species)
   not a true protein

7. Species Influenza A virus, different strains [TaxId:11320] [228462] (34 PDB entries)

8. Domain d2wrbb1: 2wrb B:5-324 [244228]
   Other proteins in same PDB: d2wrba2, d2wrbb2, d2wrbc2
   automated match to d1ha0a1
   complexed with sia

Details for d2wrbb1

PDB Entry: 2wrb, 3.1 Å

PDB Description: the structure of influenza h2 human singapore hemagglutinin with avian receptor

PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d2wrbb1:

Sequence; same for both SEQRES and ATOM records:

>d2wrbb1 b.19.1.0 (B:5-324) automated matches {Influenza A virus, different strains [TaxId: 11320]}
dqicigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsiagw
llgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilpkd
rwtqhtttggsracavsgnpsffrnmvwltekgsnypvakgsynntsgeqmliiwgvhhp
ndeteqrtlyqnvgtyvsvgtstlnkrstpdiatrpkvnglgsrmefswtlldmwdtinf
estgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhpltige
cpkyvkseklvlatglrnvp

Timeline for d2wrbb1:

• d2wrbb1 first appeared in SCOPe 2.04
  
• d2wrbb1 appears in SCOPe 2.07