Lineage for d2wrbb1 (2wrb B:5-324)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776662Species Influenza A virus, different strains [TaxId:11320] [228462] (34 PDB entries)
  8. 2776758Domain d2wrbb1: 2wrb B:5-324 [244228]
    Other proteins in same PDB: d2wrba2, d2wrbb2, d2wrbc2
    automated match to d1ha0a1
    complexed with sia

Details for d2wrbb1

PDB Entry: 2wrb (more details), 3.1 Å

PDB Description: the structure of influenza h2 human singapore hemagglutinin with avian receptor
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d2wrbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wrbb1 b.19.1.0 (B:5-324) automated matches {Influenza A virus, different strains [TaxId: 11320]}
dqicigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsiagw
llgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilpkd
rwtqhtttggsracavsgnpsffrnmvwltekgsnypvakgsynntsgeqmliiwgvhhp
ndeteqrtlyqnvgtyvsvgtstlnkrstpdiatrpkvnglgsrmefswtlldmwdtinf
estgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhpltige
cpkyvkseklvlatglrnvp

SCOPe Domain Coordinates for d2wrbb1:

Click to download the PDB-style file with coordinates for d2wrbb1.
(The format of our PDB-style files is described here.)

Timeline for d2wrbb1: