Lineage for d2wrba1 (2wrb A:9-324)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778695Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 1778696Protein automated matches [227017] (23 species)
    not a true protein
  7. 1778763Species Influenza A virus [TaxId:11320] [228462] (15 PDB entries)
  8. 1778799Domain d2wrba1: 2wrb A:9-324 [244226]
    Other proteins in same PDB: d2wrba2, d2wrbb2, d2wrbc2
    automated match to d1ha0a1
    complexed with sia

Details for d2wrba1

PDB Entry: 2wrb (more details), 3.1 Å

PDB Description: the structure of influenza h2 human singapore hemagglutinin with avian receptor
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d2wrba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wrba1 b.19.1.0 (A:9-324) automated matches {Influenza A virus [TaxId: 11320]}
igyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsiagwllgn
pecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilpkdrwtq
htttggsracavsgnpsffrnmvwltekgsnypvakgsynntsgeqmliiwgvhhpndet
eqrtlyqnvgtyvsvgtstlnkrstpdiatrpkvnglgsrmefswtlldmwdtinfestg
nliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhpltigecpky
vkseklvlatglrnvp

SCOPe Domain Coordinates for d2wrba1:

Click to download the PDB-style file with coordinates for d2wrba1.
(The format of our PDB-style files is described here.)

Timeline for d2wrba1: