![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
![]() | Protein automated matches [227017] (58 species) not a true protein |
![]() | Species Influenza A virus, different strains [TaxId:11320] [228462] (34 PDB entries) |
![]() | Domain d2wrba1: 2wrb A:9-324 [244226] Other proteins in same PDB: d2wrba2, d2wrbb2, d2wrbc2 automated match to d1ha0a1 complexed with sia |
PDB Entry: 2wrb (more details), 3.1 Å
SCOPe Domain Sequences for d2wrba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wrba1 b.19.1.0 (A:9-324) automated matches {Influenza A virus, different strains [TaxId: 11320]} igyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsiagwllgn pecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilpkdrwtq htttggsracavsgnpsffrnmvwltekgsnypvakgsynntsgeqmliiwgvhhpndet eqrtlyqnvgtyvsvgtstlnkrstpdiatrpkvnglgsrmefswtlldmwdtinfestg nliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhpltigecpky vkseklvlatglrnvp
Timeline for d2wrba1:
![]() Domains from other chains: (mouse over for more information) d2wrbb1, d2wrbb2, d2wrbc1, d2wrbc2 |