SCOPe 2.08: Domain d2wqyo2: 2wqy O:115-246

Lineage for d2wqyo2 (2wqy O:115-246)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families)
   contains two Fe4-S4 clusters

5. Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)

6. Protein Succinate dehydogenase [81669] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [254764] (6 PDB entries)

8. Domain d2wqyo2: 2wqy O:115-246 [244223]
   Other proteins in same PDB: d2wqyb1, d2wqyc_, d2wqyd_, d2wqyo1, d2wqyp_, d2wqyq_
   automated match to d1yq3b2
   complexed with azi, bhg, cbe, f3s, fad, fes, gol, hem, k, oaa, pee, sf4, unl

Details for d2wqyo2

PDB Entry: 2wqy, 2.1 Å

PDB Description: remodelling of carboxin binding to the q-site of avian respiratory complex ii

PDB Compounds: (O:) succinate dehydrogenase Ip subunit

SCOPe Domain Sequences for d2wqyo2:

Sequence; same for both SEQRES and ATOM records:

>d2wqyo2 a.1.2.1 (O:115-246) Succinate dehydogenase {Chicken (Gallus gallus) [TaxId: 9031]}
lsnfyaqyksiepylkkkdeskqgkeqylqsiedrqkldglyecilcaccstscpsywwn
gdkylgpavlmqayrwmidsrddyteerlaqlqdpfslyrchtimnctrtcpkglnpgka
iaeikkmmatyk

Timeline for d2wqyo2:

• d2wqyo2 first appeared in SCOPe 2.04
  
• d2wqyo2 appears in SCOPe 2.07