Lineage for d2wqyo1 (2wqy O:8-114)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2540890Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2541095Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 2541199Protein Succinate dehydogenase iron-sulfur protein, N-terminal domain [82586] (3 species)
  7. 2541200Species Chicken (Gallus gallus) [TaxId:9031] [254759] (6 PDB entries)
  8. 2541206Domain d2wqyo1: 2wqy O:8-114 [244222]
    Other proteins in same PDB: d2wqyb2, d2wqyc_, d2wqyd_, d2wqyo2, d2wqyp_, d2wqyq_
    automated match to d1yq3b1
    complexed with azi, bhg, cbe, f3s, fad, fes, gol, hem, k, oaa, pee, sf4, unl

Details for d2wqyo1

PDB Entry: 2wqy (more details), 2.1 Å

PDB Description: remodelling of carboxin binding to the q-site of avian respiratory complex ii
PDB Compounds: (O:) succinate dehydrogenase Ip subunit

SCOPe Domain Sequences for d2wqyo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wqyo1 d.15.4.2 (O:8-114) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
tsrikkfsiyrwdpdkpgdkprmqtyevdlnkcgpmvldalikikneldstltfrrscre
gicgscamniaggntlactkkidpdlskttkiyplphmyvvkdlvpd

SCOPe Domain Coordinates for d2wqyo1:

Click to download the PDB-style file with coordinates for d2wqyo1.
(The format of our PDB-style files is described here.)

Timeline for d2wqyo1: