SCOPe 2.08: Domain d2wqyo1: 2wqy O:8-114

Lineage for d2wqyo1 (2wqy O:8-114)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)

6. Protein Succinate dehydogenase iron-sulfur protein, N-terminal domain [82586] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [254759] (6 PDB entries)

8. Domain d2wqyo1: 2wqy O:8-114 [244222]
   Other proteins in same PDB: d2wqyb2, d2wqyc_, d2wqyd_, d2wqyo2, d2wqyp_, d2wqyq_
   automated match to d1yq3b1
   complexed with azi, bhg, cbe, f3s, fad, fes, gol, hem, k, oaa, pee, sf4, unl

Details for d2wqyo1

PDB Entry: 2wqy, 2.1 Å

PDB Description: remodelling of carboxin binding to the q-site of avian respiratory complex ii

PDB Compounds: (O:) succinate dehydrogenase Ip subunit

SCOPe Domain Sequences for d2wqyo1:

Sequence; same for both SEQRES and ATOM records:

>d2wqyo1 d.15.4.2 (O:8-114) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
tsrikkfsiyrwdpdkpgdkprmqtyevdlnkcgpmvldalikikneldstltfrrscre
gicgscamniaggntlactkkidpdlskttkiyplphmyvvkdlvpd

Timeline for d2wqyo1:

• d2wqyo1 first appeared in SCOPe 2.04
  
• d2wqyo1 appears in SCOPe 2.07