Lineage for d2wqyd_ (2wqy D:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629948Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 2630045Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) (S)
    two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains
  5. 2630065Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins)
    consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups
  6. 2630151Protein automated matches [254461] (3 species)
    not a true protein
  7. 2630152Species Chicken (Gallus gallus) [TaxId:9031] [254987] (13 PDB entries)
  8. 2630163Domain d2wqyd_: 2wqy D: [244221]
    Other proteins in same PDB: d2wqyb1, d2wqyb2, d2wqyo1, d2wqyo2
    automated match to d1zoyd_
    complexed with azi, bhg, cbe, f3s, fad, fes, gol, hem, k, oaa, pee, sf4, unl

Details for d2wqyd_

PDB Entry: 2wqy (more details), 2.1 Å

PDB Description: remodelling of carboxin binding to the q-site of avian respiratory complex ii
PDB Compounds: (D:) Succinate dehydrogenase cytochrome B, small subunit

SCOPe Domain Sequences for d2wqyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wqyd_ f.21.2.2 (D:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
skaaslhwtseravsalllgllpaaylypgpavdyslaaaltlhghwglgqvitdyvhgd
tpikvantglyvlsaitftglcyfnyydvgickavamlwsi

SCOPe Domain Coordinates for d2wqyd_:

Click to download the PDB-style file with coordinates for d2wqyd_.
(The format of our PDB-style files is described here.)

Timeline for d2wqyd_: