Lineage for d1cb8a3 (1cb8 A:336-599)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 795365Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 795492Superfamily b.30.5: Galactose mutarotase-like [74650] (11 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 795635Family b.30.5.2: Hyaluronate lyase-like, central domain [50006] (4 proteins)
  6. 795639Protein Chondroitinase AC [50007] (2 species)
  7. 795647Species Pedobacter heparinus (Flavobacterium heparinum) [TaxId:984] [50008] (5 PDB entries)
  8. 795648Domain d1cb8a3: 1cb8 A:336-599 [24422]
    Other proteins in same PDB: d1cb8a1, d1cb8a2
    complexed with ca, gcu, gol, man, mfu, ram, xys

Details for d1cb8a3

PDB Entry: 1cb8 (more details), 1.9 Å

PDB Description: chondroitinase ac lyase from flavobacterium heparinum
PDB Compounds: (A:) protein (chondroitinase ac)

SCOP Domain Sequences for d1cb8a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cb8a3 b.30.5.2 (A:336-599) Chondroitinase AC {Pedobacter heparinus (Flavobacterium heparinum) [TaxId: 984]}
iepyhhqfwngdyvqhlrpaysfnvrmvskrtrrsesgnkenllgrylsdgatniqlrgp
eyynimpvwewdkipgitsrdyltdrpltklwgeqgsndfaggvsdgvygasayaldyds
lqakkawfffdkeivclgaginsnapenitttlnqswlngpvistagktgrgkittfkaq
gqfwllhdaigyyfpeganlslstqsqkgnwfhinnshskdevsgdvfklwinhgarpen
aqyayivlpginkpeeikkyngta

SCOP Domain Coordinates for d1cb8a3:

Click to download the PDB-style file with coordinates for d1cb8a3.
(The format of our PDB-style files is described here.)

Timeline for d1cb8a3: